CHIA anticorps (Middle Region)
-
- Antigène Voir toutes CHIA Anticorps
- CHIA (Chitinase, Acidic (CHIA))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHIA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CHIA antibody was raised against the middle region of CHIA
- Purification
- Affinity purified
- Immunogène
- CHIA antibody was raised using the middle region of CHIA corresponding to a region with amino acids GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP
- Top Product
- Discover our top product CHIA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHIA Blocking Peptide, catalog no. 33R-3598, is also available for use as a blocking control in assays to test for specificity of this CHIA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHIA (Chitinase, Acidic (CHIA))
- Autre désignation
- CHIA (CHIA Produits)
- Synonymes
- anticorps chia-a, anticorps AMCASE, anticorps CHIT2, anticorps TSA1902, anticorps 2200003E03Rik, anticorps AMCase, anticorps YNL, anticorps CHIA, anticorps chioIIa, anticorps fa55g10, anticorps wu:fa55g10, anticorps zgc:63792, anticorps acidic mammalian chitinase, anticorps chitinase, acidic, anticorps chitinase, acidic S homeolog, anticorps chitinase-M31, acidic, anticorps chitinase, acidic 1, anticorps chitinase, acidic.4, anticorps LOC703284, anticorps CHIA, anticorps LOC100600050, anticorps chia.S, anticorps CHIA-M31, anticorps Chia1, anticorps Chia, anticorps chia.4
- Sujet
- CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.
- Poids moléculaire
- 40 kDa (MW of target protein)
-