Perforin 1 anticorps

N° du produit ABIN634500

Détail du produit anti-Perforin 1 anticorps

Antigène: Perforin 1 (PRF1) (Perforin 1 (Pore Forming Protein) (PRF1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Perforin 1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Perforin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Perforin 1 Blocking Peptide, catalog no. 33R-8899, is also available for use as a blocking control in assays to test for specificity of this Perforin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Perforin 1

Antigène: Perforin 1 (PRF1) (Perforin 1 (Pore Forming Protein) (PRF1))

Autre désignation: Perforin 1 (PRF1 Produits)

Synonymes: anticorps FLH2, anticorps HPLH2, anticorps P1, anticorps PFN1, anticorps PFP, anticorps PRF1, anticorps Pfn, anticorps Pfp, anticorps Prf-1, anticorps Cyta, anticorps RATCYTA, anticorps LOC443187, anticorps perforin, anticorps prf1, anticorps cytolysin, anticorps perforin-1, anticorps perforin-1-like, anticorps perforin 1, anticorps perforin 1 (pore forming protein), anticorps perforin, anticorps perforin 1 L homeolog, anticorps PRF1, anticorps Prf1, anticorps LOC443187, anticorps prf1, anticorps prf1.L

Sujet: PRF1 has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in the gene encoding PRF1 cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood.

Poids moléculaire: 59 kDa (MW of target protein)

Pathways: Apoptose, Caspase Cascade in Apoptosis