STK3 anticorps

N° du produit ABIN634509

Détail du produit anti-STK3 anticorps

Antigène: STK3 (serine/threonine Kinase 3 (STK3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STK3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: STK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STK3 Blocking Peptide, catalog no. 33R-5949, is also available for use as a blocking control in assays to test for specificity of this STK3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STK3

Antigène: STK3 (serine/threonine Kinase 3 (STK3))

Autre désignation: STK3 (STK3 Produits)

Synonymes: anticorps KRS1, anticorps MST2, anticorps 0610042I06Rik, anticorps MST, anticorps Mst2, anticorps Mst3, anticorps Ste20, anticorps mess1, anticorps mst2, anticorps xstk3, anticorps wu:fc19e11, anticorps zgc:55383, anticorps serine/threonine kinase 3, anticorps serine/threonine kinase 3 S homeolog, anticorps serine/threonine kinase 3 (STE20 homolog, yeast), anticorps STK3, anticorps Stk3, anticorps stk3.S, anticorps stk3

Sujet: Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Tube Formation