HLA-DPA1 anticorps (Middle Region)

N° du produit ABIN634553

Détail du produit anti-HLA-DPA1 anticorps

Antigène: HLA-DPA1 (Major Histocompatibility Complex, Class II, DP alpha 1 (HLA-DPA1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HLA-DPA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: HLA-DPA1 antibody was raised against the middle region of HLA-DPA1

Purification: Affinity purified

Immunogène: HLA-DPA1 antibody was raised using the middle region of HLA-DPA1 corresponding to a region with amino acids EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HLA-DPA1 Blocking Peptide, catalog no. 33R-2275, is also available for use as a blocking control in assays to test for specificity of this HLA-DPA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-DPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HLA-DPA1

Antigène: HLA-DPA1 (Major Histocompatibility Complex, Class II, DP alpha 1 (HLA-DPA1))

Autre désignation: HLA-DPA1 (HLA-DPA1 Produits)

Synonymes: anticorps DP(W3), anticorps DP(W4), anticorps HLA-DP1A, anticorps HLADP, anticorps HLASB, anticorps PLT1, anticorps major histocompatibility complex, class II, DP alpha 1, anticorps HLA-DPA1

Sujet: HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: TCR Signaling, Cancer Immune Checkpoints