HLA-DPA1 anticorps (Middle Region)
-
- Antigène Voir toutes HLA-DPA1 Anticorps
- HLA-DPA1 (Major Histocompatibility Complex, Class II, DP alpha 1 (HLA-DPA1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HLA-DPA1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HLA-DPA1 antibody was raised against the middle region of HLA-DPA1
- Purification
- Affinity purified
- Immunogène
- HLA-DPA1 antibody was raised using the middle region of HLA-DPA1 corresponding to a region with amino acids EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT
- Top Product
- Discover our top product HLA-DPA1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HLA-DPA1 Blocking Peptide, catalog no. 33R-2275, is also available for use as a blocking control in assays to test for specificity of this HLA-DPA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-DPA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HLA-DPA1 (Major Histocompatibility Complex, Class II, DP alpha 1 (HLA-DPA1))
- Autre désignation
- HLA-DPA1 (HLA-DPA1 Produits)
- Synonymes
- anticorps DP(W3), anticorps DP(W4), anticorps HLA-DP1A, anticorps HLADP, anticorps HLASB, anticorps PLT1, anticorps major histocompatibility complex, class II, DP alpha 1, anticorps HLA-DPA1
- Sujet
- HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins.
- Poids moléculaire
- 26 kDa (MW of target protein)
- Pathways
- TCR Signaling, Cancer Immune Checkpoints
-