TNFSF18 anticorps

N° du produit ABIN634583

Détail du produit anti-TNFSF18 anticorps

Antigène: TNFSF18 (Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNFSF18 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TNFSF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TNFSF18 Blocking Peptide, catalog no. 33R-4504, is also available for use as a blocking control in assays to test for specificity of this TNFSF18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFSF18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TNFSF18

Antigène: TNFSF18 (Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18))

Autre désignation: TNFSF18 (TNFSF18 Produits)

Synonymes: anticorps Gitrl, anticorps AITRL, anticorps GITRL, anticorps TL6, anticorps hGITRL, anticorps TNLG2A, anticorps tumor necrosis factor (ligand) superfamily, member 18, anticorps TNF superfamily member 18, anticorps Tnfsf18, anticorps TNFSF18

Sujet: TNFSF18 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.

Poids moléculaire: 23 kDa (MW of target protein)