PHLDA2 anticorps (Middle Region)

N° du produit ABIN634590

Détail du produit anti-PHLDA2 anticorps

Antigène: PHLDA2 (Pleckstrin Homology-Like Domain, Family A, Member 2 (PHLDA2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PHLDA2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PHLDA2 antibody was raised against the middle region of PHLDA2

Purification: Affinity purified

Immunogène: PHLDA2 antibody was raised using the middle region of PHLDA2 corresponding to a region with amino acids QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PHLDA2 Blocking Peptide, catalog no. 33R-7668, is also available for use as a blocking control in assays to test for specificity of this PHLDA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHLDA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PHLDA2

Antigène: PHLDA2 (Pleckstrin Homology-Like Domain, Family A, Member 2 (PHLDA2))

Autre désignation: PHLDA2 (PHLDA2 Produits)

Synonymes: anticorps PHLDA2, anticorps ipl, anticorps phlda2, anticorps BRW1C, anticorps BWR1C, anticorps HLDA2, anticorps IPL, anticorps TSSC3, anticorps Ipl, anticorps Tssc3, anticorps zgc:110459, anticorps pleckstrin homology like domain family A member 2, anticorps Pleckstrin homology-like domain family A member 2, anticorps pleckstrin homology like domain, family A, member 2, anticorps pleckstrin homology-like domain, family A, member 2, anticorps pleckstrin homology-like domain, family A, member 2 L homeolog, anticorps PHLDA2, anticorps phla2, anticorps Phlda2, anticorps phlda2.L, anticorps phlda2

Sujet: This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor and rhabdomyosarcoma.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process