PEA15 anticorps (Middle Region)
-
- Antigène Voir toutes PEA15 Anticorps
- PEA15 (phosphoprotein Enriched in Astrocytes 15 (PEA15))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PEA15 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PEA15 antibody was raised against the middle region of PEA15
- Purification
- Affinity purified
- Immunogène
- PEA15 antibody was raised using the middle region of PEA15 corresponding to a region with amino acids DLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKL
- Top Product
- Discover our top product PEA15 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PEA15 Blocking Peptide, catalog no. 33R-2058, is also available for use as a blocking control in assays to test for specificity of this PEA15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEA15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PEA15 (phosphoprotein Enriched in Astrocytes 15 (PEA15))
- Autre désignation
- PEA15 (PEA15 Produits)
- Synonymes
- anticorps HMAT1, anticorps HUMMAT1H, anticorps MAT1, anticorps MAT1H, anticorps PEA-15, anticorps PED, anticorps Pea15a, anticorps PEA15, anticorps DKFZp459O1410, anticorps proliferation and apoptosis adaptor protein 15, anticorps phosphoprotein enriched in astrocytes 15, anticorps proliferation and apoptosis adaptor protein 15 L homeolog, anticorps Astrocytic phosphoprotein PEA-15, anticorps PEA15, anticorps Pea15, anticorps pea15.L, anticorps pea15
- Sujet
- PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.
- Poids moléculaire
- 15 kDa (MW of target protein)
-