PEA15 anticorps (Middle Region)

N° du produit ABIN634601

L’anticorps anti-PEA15 Polyclonal Lapin est utilisé pour la détection de PEA15 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour PEA15 anticorps (Middle Region) (ABIN634601)

Antigène: PEA15 (phosphoprotein Enriched in Astrocytes 15 (PEA15))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PEA15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PEA15 anticorps

Épitope: Middle Region

Specificité: PEA15 antibody was raised against the middle region of PEA15

Purification: Affinity purified

Immunogène: PEA15 antibody was raised using the middle region of PEA15 corresponding to a region with amino acids DLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PEA15 Blocking Peptide, (ABIN937444), is also available for use as a blocking control in assays to test for specificity of this PEA15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEA15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PEA15

Antigène: PEA15 (phosphoprotein Enriched in Astrocytes 15 (PEA15))

Autre désignation: PEA15

Sujet: PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.

Poids moléculaire: 15 kDa (MW of target protein)