Laminin gamma 1 anticorps
-
- Antigène Voir toutes Laminin gamma 1 (LAMC1) Anticorps
- Laminin gamma 1 (LAMC1) (Laminin, gamma 1 (LAMC1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Laminin gamma 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Laminin Gamma 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQ
- Top Product
- Discover our top product LAMC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Laminin Gamma 1 Blocking Peptide, catalog no. 33R-3677, is also available for use as a blocking control in assays to test for specificity of this Laminin Gamma 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAMC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Laminin gamma 1 (LAMC1) (Laminin, gamma 1 (LAMC1))
- Autre désignation
- Laminin gamma 1 (LAMC1 Produits)
- Synonymes
- anticorps lamb2, anticorps Lamb2, anticorps B2e, anticorps sly, anticorps LAMB2, anticorps putative laminin gamma-1 chain, anticorps laminin subunit gamma 1, anticorps laminin, gamma 1, anticorps Smp_163810, anticorps lamc1, anticorps Lamc1, anticorps LAMC1
- Sujet
- Laminin is a complex glycoprotein, consisting of three different polypeptide chains (alpha, beta, gamma), which are bound to each other by disulfide bonds into a cross-shaped molecule comprising one long and three short arms with globules at each end. Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
- Poids moléculaire
- 177 kDa (MW of target protein)
-