PROS1 anticorps

N° du produit ABIN634646

Détail du produit anti-PROS1 anticorps

Antigène: PROS1 (PROS) (Protein S (PROS))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PROS1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Protein S antibody was raised using a synthetic peptide corresponding to a region with amino acids MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Protein S Blocking Peptide, catalog no. 33R-5808, is also available for use as a blocking control in assays to test for specificity of this Protein S antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PROS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PROS1

Antigène: PROS1 (PROS) (Protein S (PROS))

Autre désignation: Protein S (PROS Produits)

Synonymes: anticorps PROS, anticorps PS21, anticorps PS22, anticorps PS23, anticorps PS24, anticorps PS25, anticorps PSA, anticorps THPH5, anticorps THPH6, anticorps zgc:154001, anticorps AW214361, anticorps protein S, anticorps protein S (alpha), anticorps PROS1, anticorps Pros1, anticorps pros1

Sujet: PROS1 is an anticoagulant plasma protein, it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.

Poids moléculaire: 71 kDa (MW of target protein)