Acetylcholinesterase anticorps
-
- Antigène Voir toutes Acetylcholinesterase (AChE) Anticorps
- Acetylcholinesterase (AChE)
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Acetylcholinesterase est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- AChE antibody was raised using a synthetic peptide corresponding to a region with amino acids SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV
- Top Product
- Discover our top product AChE Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AChE Blocking Peptide, catalog no. 33R-8642, is also available for use as a blocking control in assays to test for specificity of this AChE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACHE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Acetylcholinesterase (AChE)
- Autre désignation
- AChE (AChE Produits)
- Synonymes
- anticorps ACEE, anticorps ARACHE, anticorps N-ACHE, anticorps YT, anticorps Ache, anticorps GB14873, anticorps zgc:92550, anticorps ACE, anticorps Dsim\\GD20515, anticorps GD20515, anticorps dsim_GLEANR_4292, anticorps ache, anticorps mE1a, anticorps mE1b, anticorps mE1c, anticorps mE1c-long, anticorps mE1d, anticorps mE1d', anticorps mE1e, anticorps arache, anticorps n-ache, anticorps acetylcholinesterase (Cartwright blood group), anticorps acetylcholinesterase 2, anticorps acetylcholinesterase, anticorps Acetylcholine esterase, anticorps acetylcholinesterase (Cartwright blood group) L homeolog, anticorps collagen type I alpha 2 chain, anticorps ACHE, anticorps AChE-2, anticorps Ache, anticorps ache, anticorps Dsim\Ace, anticorps ache.L, anticorps COL1A2, anticorps ACE-1
- Sujet
- Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes.
- Poids moléculaire
- 61 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-