C-Type Lectin Domain Family 4, Member M (CLEC4M) (N-Term) anticorps

N° du produit ABIN634662

Détail du produit

Antigène: C-Type Lectin Domain Family 4, Member M (CLEC4M)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: CLEC4 M antibody was raised against the n terminal of CLEC4

Purification: Affinity purified

Immunogène: CLEC4 M antibody was raised using the N terminal of CLEC4 corresponding to a region with amino acids MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLEC4M Blocking Peptide, catalog no. 33R-6413, is also available for use as a blocking control in assays to test for specificity of this CLEC4M antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLEC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: C-Type Lectin Domain Family 4, Member M (CLEC4M)

Autre désignation: CLEC4M (CLEC4M Produits)

Synonymes: anticorps CD209L, anticorps CD299, anticorps DC-SIGN2, anticorps DC-SIGNR, anticorps DCSIGNR, anticorps HP10347, anticorps L-SIGN, anticorps LSIGN, anticorps CD209B, anticorps C-type lectin domain family 4 member M, anticorps CLEC4M

Sujet: CLEC4M is a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. It is involved in the innate immune system and recognises numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health.

Poids moléculaire: 30 kDa (MW of target protein)