C-Type Lectin Domain Family 4, Member M (CLEC4M) (N-Term) anticorps
-
- Antigène Voir toutes C-Type Lectin Domain Family 4, Member M (CLEC4M) Anticorps
- C-Type Lectin Domain Family 4, Member M (CLEC4M)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- Western Blotting (WB)
- Specificité
- CLEC4 M antibody was raised against the n terminal of CLEC4
- Purification
- Affinity purified
- Immunogène
- CLEC4 M antibody was raised using the N terminal of CLEC4 corresponding to a region with amino acids MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA
- Top Product
- Discover our top product CLEC4M Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CLEC4M Blocking Peptide, catalog no. 33R-6413, is also available for use as a blocking control in assays to test for specificity of this CLEC4M antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLEC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C-Type Lectin Domain Family 4, Member M (CLEC4M)
- Autre désignation
- CLEC4M (CLEC4M Produits)
- Synonymes
- anticorps CD209L, anticorps CD299, anticorps DC-SIGN2, anticorps DC-SIGNR, anticorps DCSIGNR, anticorps HP10347, anticorps L-SIGN, anticorps LSIGN, anticorps CD209B, anticorps C-type lectin domain family 4 member M, anticorps CLEC4M
- Sujet
- CLEC4M is a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. It is involved in the innate immune system and recognises numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health.
- Poids moléculaire
- 30 kDa (MW of target protein)
-