GJB6 anticorps (Middle Region)

N° du produit ABIN634670

Détail du produit anti-GJB6 anticorps

Antigène: GJB6 (Gap Junction Protein, beta 6, 30kDa (GJB6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GJB6 est non-conjugé

Application: Western Blotting (WB)

Specificité: GJB6 antibody was raised against the middle region of GJB6

Purification: Affinity purified

Immunogène: GJB6 antibody was raised using the middle region of GJB6 corresponding to a region with amino acids CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GJB6 Blocking Peptide, catalog no. 33R-1835, is also available for use as a blocking control in assays to test for specificity of this GJB6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GJB6

Antigène: GJB6 (Gap Junction Protein, beta 6, 30kDa (GJB6))

Autre désignation: GJB6 (GJB6 Produits)

Synonymes: anticorps connexin-26, anticorps cx26, anticorps cx30, anticorps dfna3, anticorps dfna3a, anticorps dfnb1, anticorps dfnb1a, anticorps ed2, anticorps edh, anticorps gjb6, anticorps hed, anticorps nsrd1, anticorps ppk, anticorps AA958971, anticorps Cx30, anticorps D14Bwg0506e, anticorps CX30, anticorps DFNA3, anticorps DFNA3B, anticorps DFNB1B, anticorps ECTD2, anticorps ED2, anticorps EDH, anticorps HED, anticorps HED2, anticorps CX31, anticorps connexin 30, anticorps gap junction protein beta 2, anticorps gap junction protein beta 6, anticorps gap junction protein, beta 6, anticorps LOC387566, anticorps gjb2, anticorps GJB6, anticorps Gjb6

Sujet: Gap junctions allow the transport of ions and metabolites between the cytoplasm of adjacent cells. They are formed by two hemichannels, made up of six connexin proteins assembled in groups. Each connexin protein has four transmembrane segments.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Sensory Perception of Sound