Cx40/GJA5 anticorps (N-Term)

N° du produit ABIN634682

Détail du produit anti-Cx40/GJA5 anticorps

Antigène: Cx40/GJA5 (GJA5) (Gap Junction Protein, alpha 5, 40kDa (GJA5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cx40/GJA5 est non-conjugé

Application: Western Blotting (WB)

Specificité: GJA5 antibody was raised against the N terminal of GJA5

Purification: Affinity purified

Immunogène: GJA5 antibody was raised using the N terminal of GJA5 corresponding to a region with amino acids STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GJA5 Blocking Peptide, catalog no. 33R-8882, is also available for use as a blocking control in assays to test for specificity of this GJA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cx40/GJA5

Antigène: Cx40/GJA5 (GJA5) (Gap Junction Protein, alpha 5, 40kDa (GJA5))

Autre désignation: GJA5 (GJA5 Produits)

Synonymes: anticorps Cx40, anticorps 5730555N10Rik, anticorps Cnx40, anticorps Gja-5, anticorps ATFB11, anticorps CX40, anticorps gap junction protein, alpha 5, anticorps gap junction protein alpha 5, anticorps Gja5, anticorps GJA5

Sujet: GJA5 belongs to the connexin family, alpha-type subfamily. It is an integral membrane protein that forms transmembrane channels, and may function in small molecule transport, muscle contraction and cell-cell communication. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization