GJA4 anticorps (Middle Region)

N° du produit ABIN634684

Détail du produit anti-GJA4 anticorps

Antigène: GJA4 (Gap Junction Protein, alpha 4, 37kDa (GJA4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GJA4 est non-conjugé

Application: Western Blotting (WB)

Specificité: GJA4 antibody was raised against the middle region of GJA4

Purification: Affinity purified

Immunogène: GJA4 antibody was raised using the middle region of GJA4 corresponding to a region with amino acids QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GJA4 Blocking Peptide, catalog no. 33R-7598, is also available for use as a blocking control in assays to test for specificity of this GJA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GJA4

Antigène: GJA4 (Gap Junction Protein, alpha 4, 37kDa (GJA4))

Autre désignation: GJA4 (GJA4 Produits)

Synonymes: anticorps AU020209, anticorps AW558810, anticorps Cnx37, anticorps Cx37, anticorps Gja-4, anticorps CXN37, anticorps CX37, anticorps Cx39, anticorps ggCx39, anticorps cx41, anticorps gja4, anticorps gap junction protein alpha 4, anticorps gap junction protein, alpha 4, anticorps gap junction protein, alpha 4, 37kDa, anticorps gap junction protein alpha 4 L homeolog, anticorps GJA4, anticorps Gja4, anticorps gja4.L

Sujet: GJA4 is a member of the connexin family. The protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization