SSPN anticorps

N° du produit ABIN634685

Détail du produit anti-SSPN anticorps

Antigène: SSPN (Sarcospan (Kras Oncogene-Associated Gene) (SSPN))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SSPN est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Sarcospan antibody was raised using a synthetic peptide corresponding to a region with amino acids AHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Sarcospan Blocking Peptide, catalog no. 33R-1245, is also available for use as a blocking control in assays to test for specificity of this Sarcospan antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSPN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SSPN

Antigène: SSPN (Sarcospan (Kras Oncogene-Associated Gene) (SSPN))

Autre désignation: Sarcospan (SSPN Produits)

Synonymes: anticorps DAGA5, anticorps KRAG, anticorps NSPN, anticorps SPN1, anticorps SPN2, anticorps Krag, anticorps RGD1559723, anticorps sarcospan S homeolog, anticorps sarcospan, anticorps sspn.S, anticorps SSPN, anticorps Sspn

Sujet: SSPN is a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells.SSPN gene is expressed in a variety of tissues with highest levels in muscle, where alternative splice variants have been observed. In certain tumors KRAS2, SSPN, and ITPR2 are coamplified. The function of this gene is unknown.

Poids moléculaire: 26 kDa (MW of target protein)