DSCAM anticorps (Middle Region)

N° du produit ABIN634687

Détail du produit anti-DSCAM anticorps

Antigène: DSCAM (Down Syndrome Cell Adhesion Molecule (DSCAM))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DSCAM est non-conjugé

Application: Western Blotting (WB)

Specificité: DSCAM antibody was raised against the middle region of DSCAM

Purification: Affinity purified

Immunogène: DSCAM antibody was raised using the middle region of DSCAM corresponding to a region with amino acids MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DSCAM Blocking Peptide, catalog no. 33R-6387, is also available for use as a blocking control in assays to test for specificity of this DSCAM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSCAM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DSCAM

Antigène: DSCAM (Down Syndrome Cell Adhesion Molecule (DSCAM))

Autre désignation: DSCAM (DSCAM Produits)

Synonymes: anticorps CHD2-42, anticorps CHD2-52, anticorps Dscam, anticorps DSCAM, anticorps chd2-42, anticorps chd2-52, anticorps dscam, anticorps GB15141, anticorps 4932410A21Rik, anticorps 43Bc, anticorps CG17800, anticorps CT39257, anticorps DScam, anticorps DmDscam, anticorps Dm_2R:13612, anticorps Dmel\\CG17800, anticorps Dscam-hv, anticorps Dscam1, anticorps FBgn0033159, anticorps Neu1, anticorps dScam, anticorps l(2)05518, anticorps l(2)43Bc, anticorps p270, anticorps DS cell adhesion molecule, anticorps Down syndrome cell adhesion molecule, anticorps Down syndrome cell adhesion molecule a, anticorps Down syndrome cell adhesion molecule 1, anticorps Down syndrome cell adhesion molecule-like protein Dscam2, anticorps down syndrome cell adhesion molecule, anticorps Down syndrome cell adhesion molecule L homeolog, anticorps DSCAM, anticorps Dscam, anticorps dscam, anticorps dscama, anticorps Dscam1, anticorps LOC5573626, anticorps CpipJ_CPIJ006173, anticorps dscam.L

Sujet: DSCAM is a cell adhesion molecule that can mediate cation-independent homophilic binding activity. DSCAM could be involved in nervous system development.

Poids moléculaire: 220 kDa (MW of target protein)

Pathways: Regulation of Cell Size