Ephrin B1 anticorps (Middle Region)

N° du produit ABIN634690

Cet anticorps Lapin Polyclonal détecte spécifiquement Ephrin B1 dans WB. Il présente une réactivité avec des échantillons de Humain et Souris.

Aperçu rapide pour Ephrin B1 anticorps (Middle Region) (ABIN634690)

Antigène: Ephrin B1 (EFNB1)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Ephrin B1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Ephrin B1 anticorps

Épitope: Middle Region

Specificité: Ephrin-B1 antibody was raised against the middle region of EFNB1

Purification: Affinity purified

Immunogène: Ephrin-B1 antibody was raised using the middle region of EFNB1 corresponding to a region with amino acids SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ephrin-B1 Blocking Peptide, (ABIN5613384), is also available for use as a blocking control in assays to test for specificity of this Ephrin-B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Ephrin B1

Antigène: Ephrin B1 (EFNB1)

Autre désignation: Ephrin-B1

Sujet: The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Signalisation RTK