Ephrin B1 anticorps (Middle Region)

N° du produit ABIN634690

Détail du produit anti-Ephrin B1 anticorps

Antigène: Ephrin B1 (EFNB1)

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Ephrin B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Ephrin-B1 antibody was raised against the middle region of EFNB1

Purification: Affinity purified

Immunogène: Ephrin-B1 antibody was raised using the middle region of EFNB1 corresponding to a region with amino acids SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ephrin-B1 Blocking Peptide, catalog no. 33R-8768, is also available for use as a blocking control in assays to test for specificity of this Ephrin-B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Ephrin B1

Antigène: Ephrin B1 (EFNB1)

Autre désignation: Ephrin-B1 (EFNB1 Produits)

Synonymes: anticorps EFNB1, anticorps LERK2, anticorps Cek5-L, anticorps EFL-3, anticorps Elk-L, anticorps Epl2, anticorps Eplg2, anticorps LERK-2, anticorps Lerk2, anticorps Stra1, anticorps CFND, anticorps CFNS, anticorps EFL3, anticorps EPLG2, anticorps cfnd, anticorps cfns, anticorps efl3, anticorps efnb1-A, anticorps ephrinB1, anticorps eplg2, anticorps lerk2, anticorps ephrin B1, anticorps ephrin-B1, anticorps ephrin-B1 L homeolog, anticorps EFNB1, anticorps Efnb1, anticorps efnb1, anticorps efnb1.L

Sujet: The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Signalisation RTK