PCDHB13 anticorps (Middle Region)

N° du produit ABIN634692

Détail du produit anti-PCDHB13 anticorps

Antigène: PCDHB13 (Protocadherin beta 13 (PCDHB13))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDHB13 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCDHB13 antibody was raised against the middle region of PCDHB13

Purification: Affinity purified

Immunogène: PCDHB13 antibody was raised using the middle region of PCDHB13 corresponding to a region with amino acids GKTFKINPLTGEIELKKQLDFEKLQSYEVNIEARDAGTFSGKCTVLIQVI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDHB13 Blocking Peptide, catalog no. 33R-3378, is also available for use as a blocking control in assays to test for specificity of this PCDHB13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHB13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDHB13

Antigène: PCDHB13 (Protocadherin beta 13 (PCDHB13))

Autre désignation: PCDHB13 (PCDHB13 Produits)

Synonymes: anticorps PCDH-BETA13, anticorps Pcdh3, anticorps Pcdbh6, anticorps PcdhbM, anticorps PCDHB13, anticorps protocadherin beta 13, anticorps protocadherin beta 12, anticorps protocadherin beta-8, anticorps PCDHB13, anticorps Pcdhb12, anticorps Pcdhb13, anticorps LOC518612

Sujet: PCDHB13 is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily.

Poids moléculaire: 85 kDa (MW of target protein)