COPA anticorps (Middle Region)
-
- Antigène Voir toutes COPA Anticorps
- COPA (Coatomer Protein Complex, Subunit alpha (COPA))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp COPA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- COPA antibody was raised against the middle region of COPA
- Purification
- Affinity purified
- Immunogène
- COPA antibody was raised using the middle region of COPA corresponding to a region with amino acids IPKDADSQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLLIKNLKNEIT
- Top Product
- Discover our top product COPA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
COPA Blocking Peptide, catalog no. 33R-4092, is also available for use as a blocking control in assays to test for specificity of this COPA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- COPA (Coatomer Protein Complex, Subunit alpha (COPA))
- Autre désignation
- COPA (COPA Produits)
- Synonymes
- anticorps COPA, anticorps DDBDRAFT_0189693, anticorps DDBDRAFT_0233797, anticorps DDB_0189693, anticorps DDB_0233797, anticorps DKFZp469O221, anticorps AU040324, anticorps xenin, anticorps HEP-COP, anticorps cb281, anticorps fb13c12, anticorps wu:fb13c12, anticorps coatomer protein complex subunit alpha, anticorps WD40 repeat-containing protein, anticorps Coatomer subunit alpha, anticorps coatomer protein complex, subunit alpha, anticorps coatomer protein complex subunit alpha L homeolog, anticorps COPA, anticorps copA, anticorps cgd8_860, anticorps Chro.80105, anticorps AFUA_3G08840, anticorps copa, anticorps Copa, anticorps copa.L
- Sujet
- In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone.
- Poids moléculaire
- 135 kDa (MW of target protein)
- Pathways
- Hormone Activity
-