BDNF anticorps (Middle Region)

N° du produit ABIN634782

Détail du produit anti-BDNF anticorps

Antigène: BDNF (Brain-Derived Neurotrophic Factor (BDNF))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BDNF est non-conjugé

Application: Western Blotting (WB)

Specificité: BDNF antibody was raised against the middle region of BDNF

Purification: Affinity purified

Immunogène: BDNF antibody was raised using the middle region of BDNF corresponding to a region with amino acids EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BDNF Blocking Peptide, catalog no. 33R-2813, is also available for use as a blocking control in assays to test for specificity of this BDNF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDNF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BDNF

Antigène: BDNF (Brain-Derived Neurotrophic Factor (BDNF))

Autre désignation: BDNF (BDNF Produits)

Synonymes: anticorps ANON2, anticorps BULN2, anticorps bdnf-A, anticorps BDNF, anticorps bdnf, anticorps brain derived neurotrophic factor, anticorps brain-derived neurotrophic factor, anticorps brain-derived neurotrophic factor L homeolog, anticorps brain-derived neurotrophic factor S homeolog, anticorps BDNF, anticorps Bdnf, anticorps bdnf, anticorps bdnf.L, anticorps bdnf.S

Sujet: BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Signalisation RTK, Synaptic Membrane, Feeding Behaviour, Dicarboxylic Acid Transport, Regulation of long-term Neuronal Synaptic Plasticity