AGT anticorps
-
- Antigène Voir toutes AGT Anticorps
- AGT (Angiotensinogen (serpin Peptidase Inhibitor, Clade A, Member 8) (AGT))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AGT est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- AGT antibody was raised using a synthetic peptide corresponding to a region with amino acids IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ
- Top Product
- Discover our top product AGT Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AGT Blocking Peptide, catalog no. 33R-3985, is also available for use as a blocking control in assays to test for specificity of this AGT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AGT (Angiotensinogen (serpin Peptidase Inhibitor, Clade A, Member 8) (AGT))
- Autre désignation
- AGT (AGT Produits)
- Synonymes
- anticorps ANHU, anticorps SERPINA8, anticorps AI265500, anticorps AngI, anticorps AngII, anticorps Aogen, anticorps Serpina8, anticorps ANRT, anticorps Ang, anticorps PAT, anticorps wu:fb62f06, anticorps wu:fj87b02, anticorps zgc:111892, anticorps AGT, anticorps angt, anticorps ANGT, anticorps angiotensinogen, anticorps angiotensinogen (serpin peptidase inhibitor, clade A, member 8), anticorps AGT, anticorps Agt, anticorps agt
- Sujet
- AGT, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin converting enzyme (ACE) to generate the physiologically active enzyme angiotensin II. The protein is involved in maintaining blood pressure and in the pathogenesis of essential hypertension and preeclampsia. Mutations in this gene are associated with susceptibility to essential hypertension, and can cause renal tubular dysgenesis, a severe disorder of renal tubular development. Defects in this gene have also been associated with non-familial structural atrial fibrillation, and inflammatory bowel disease.
- Poids moléculaire
- 53 kDa (MW of target protein)
- Pathways
- Signalistation JAK/STAT, ACE Inhibitor Pathway, EGFR Signaling Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Regulation of Lipid Metabolism by PPARalpha, Protein targeting to Nucleus, Feeding Behaviour, Monocarboxylic Acid Catabolic Process, Dicarboxylic Acid Transport, Positive Regulation of Response to DNA Damage Stimulus, Regulation of long-term Neuronal Synaptic Plasticity
-