VGF anticorps (Middle Region)

N° du produit ABIN634791

Détail du produit anti-VGF anticorps

Antigène: VGF (VGF Nerve Growth Factor Inducible (VGF))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VGF est non-conjugé

Application: Western Blotting (WB)

Specificité: VGF antibody was raised against the middle region of VGF

Purification: Affinity purified

Immunogène: VGF antibody was raised using the middle region of VGF corresponding to a region with amino acids ARQNALLFAEEEDGEAGAEDKRSQEETPGHRRKEAEGTEEGGEEEDDEEM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VGF Blocking Peptide, catalog no. 33R-1490, is also available for use as a blocking control in assays to test for specificity of this VGF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VGF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VGF

Antigène: VGF (VGF Nerve Growth Factor Inducible (VGF))

Autre désignation: VGF (VGF Produits)

Synonymes: anticorps VGF, anticorps Gm1052, anticorps VGF nerve growth factor inducible, anticorps VGF, anticorps Vgf

Sujet: This gene is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. The structural organization of this gene is similar to that of the rat gene, and both the translated and the untranslated regions show a high degree of sequence similarity to the rat gene. The encoded secretory protein also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known.

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Hormone Transport, Carbohydrate Homeostasis