Cholecystokinin anticorps (Middle Region)

N° du produit ABIN634802

Détail du produit anti-Cholecystokinin anticorps

Antigène: Cholecystokinin (CCK)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cholecystokinin est non-conjugé

Application: Western Blotting (WB)

Specificité: CCK antibody was raised against the middle region of CCK

Purification: Affinity purified

Immunogène: CCK antibody was raised using the middle region of CCK corresponding to a region with amino acids IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCK Blocking Peptide, catalog no. 33R-4121, is also available for use as a blocking control in assays to test for specificity of this CCK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cholecystokinin

Antigène: Cholecystokinin (CCK)

Autre désignation: CCK (CCK Produits)

Synonymes: anticorps CCK, anticorps CCK-CH, anticorps cck-a, anticorps cck-b, anticorps cholecystokinin, anticorps cholecystokinin L homeolog, anticorps CCK, anticorps Cck, anticorps cck, anticorps cck.L

Sujet: Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.

Poids moléculaire: 13 kDa (MW of target protein)

Pathways: TCR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Positive Regulation of Endopeptidase Activity, Toll-Like Receptors Cascades, Feeding Behaviour