IL-4 anticorps (Middle Region)
-
- Antigène Voir toutes IL-4 (IL4) Anticorps
- IL-4 (IL4) (Interleukin 4 (IL4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IL-4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IL4 antibody was raised against the middle region of IL4
- Purification
- Affinity purified
- Immunogène
- IL4 antibody was raised using the middle region of IL4 corresponding to a region with amino acids TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC
- Top Product
- Discover our top product IL4 Anticorps primaire
-
anti-Interleukin 4 (IL4) (AA 25-153) antibody
IL4 Reactivité: Humain WB, IHC, IP, ICC Hôte: Souris Monoclonal C2 unconjugated
anti-Interleukin 4 (IL4) (AA 25-153) antibodyIL4 Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Interleukin 4 (IL4) (AA 122-150), (AA 122-151), (C-Term) antibodyIL4 Reactivité: Humain, Souris WB, FACS, IHC (p) Hôte: Lapin Polyclonal RB22885 unconjugated
anti-Interleukin 4 (IL4) (AA 122-150) antibodyIL4 Reactivité: Humain, Souris WB, ELISA, IHC, FACS Hôte: Lapin Polyclonal unconjugated
anti-Interleukin 4 (IL4) (AA 61-111) antibodyIL4 Reactivité: Rat WB, IHC, IP, ICC Hôte: Souris Monoclonal C10 unconjugated
anti-Interleukin 4 (IL4) (AA 25-153) antibodyIL4 Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Interleukin 4 (IL4) (Internal Region) antibodyIL4 Reactivité: Humain, Souris, Rat WB, ELISA, IHC, ICC, IF Hôte: Lapin Polyclonal unconjugated
anti-Interleukin 4 (IL4) antibodyIL4 Reactivité: Humain, Souris, Rat IHC Hôte: Lapin Polyclonal unconjugated
anti-Interleukin 4 (IL4) (AA 26-136) antibodyIL4 Reactivité: Poulet WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Interleukin 4 (IL4) antibodyIL4 Reactivité: Souris WB, ELISA, Neut Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IL4 Blocking Peptide, catalog no. 33R-9363, is also available for use as a blocking control in assays to test for specificity of this IL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IL-4 (IL4) (Interleukin 4 (IL4))
- Autre désignation
- IL4 (IL4 Produits)
- Synonymes
- anticorps IL4, anticorps IL-4, anticorps BCGF-1, anticorps BCGF1, anticorps BSF-1, anticorps BSF1, anticorps Il-4, anticorps Il4e12, anticorps IL2, anticorps interleukin 4, anticorps IL4, anticorps Il4
- Sujet
- IL4 is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine.
- Poids moléculaire
- 15 kDa (MW of target protein)
- Pathways
- Signalistation JAK/STAT, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Proton Transport, Activated T Cell Proliferation
-
