LCLAT1 anticorps (Middle Region)

N° du produit ABIN634820

Détail du produit anti-LCLAT1 anticorps

Antigène: LCLAT1 (Lysocardiolipin Acyltransferase 1 (LCLAT1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LCLAT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LYCAT antibody was raised against the middle region of LYCAT

Purification: Affinity purified

Immunogène: LYCAT antibody was raised using the middle region of LYCAT corresponding to a region with amino acids YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYCAT Blocking Peptide, catalog no. 33R-10186, is also available for use as a blocking control in assays to test for specificity of this LYCAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYCAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LCLAT1

Antigène: LCLAT1 (Lysocardiolipin Acyltransferase 1 (LCLAT1))

Autre désignation: LYCAT (LCLAT1 Produits)

Synonymes: anticorps lclat1, anticorps zgc:77380, anticorps wu:fj17g04, anticorps LYCAT, anticorps lycat, anticorps agpat8, anticorps alcat1, anticorps 1agpat8, anticorps AGPATP8, anticorps 1AGPAT8, anticorps AGPAT8, anticorps ALCAT1, anticorps HSRG1849, anticorps UNQ1849, anticorps AI181996, anticorps Agpat8, anticorps Alcat1, anticorps Gm91, anticorps Lycat, anticorps RGD1565906, anticorps lysocardiolipin acyltransferase 1, anticorps lclat1, anticorps LCLAT1, anticorps Lclat1

Sujet: LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognises both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.

Poids moléculaire: 44 kDa (MW of target protein)