GPR75 anticorps (Middle Region)

N° du produit ABIN634878

Détail du produit anti-GPR75 anticorps

Antigène: GPR75 (G Protein-Coupled Receptor 75 (GPR75))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPR75 est non-conjugé

Application: Western Blotting (WB)

Specificité: GPR75 antibody was raised against the middle region of GPR75

Purification: Affinity purified

Immunogène: GPR75 antibody was raised using the middle region of GPR75 corresponding to a region with amino acids PSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPR75 Blocking Peptide, catalog no. 33R-7365, is also available for use as a blocking control in assays to test for specificity of this GPR75 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPR75

Antigène: GPR75 (G Protein-Coupled Receptor 75 (GPR75))

Autre désignation: GPR75 (GPR75 Produits)

Synonymes: anticorps GPR75, anticorps GPRchr2, anticorps WI31133, anticorps G protein-coupled receptor 75, anticorps G protein-coupled receptor 75 S homeolog, anticorps GPR75, anticorps gpr75, anticorps Gpr75, anticorps gpr75.S

Sujet: GPR75 is an orphan receptor.GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.

Poids moléculaire: 59 kDa (MW of target protein)