ACMSD anticorps (Middle Region)

N° du produit ABIN634884

Détail du produit anti-ACMSD anticorps

Antigène: ACMSD (Aminocarboxymuconate Semialdehyde Decarboxylase (ACMSD))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACMSD est non-conjugé

Application: Western Blotting (WB)

Specificité: ACMSD antibody was raised against the middle region of ACMSD

Purification: Affinity purified

Immunogène: ACMSD antibody was raised using the middle region of ACMSD corresponding to a region with amino acids NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACMSD Blocking Peptide, catalog no. 33R-6822, is also available for use as a blocking control in assays to test for specificity of this ACMSD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACMSD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACMSD

Antigène: ACMSD (Aminocarboxymuconate Semialdehyde Decarboxylase (ACMSD))

Autre désignation: ACMSD (ACMSD Produits)

Synonymes: anticorps zgc:162888, anticorps ACMSD, anticorps aminocarboxymuconate semialdehyde decarboxylase, anticorps aminocarboxymuconate semialdehyde decarboxylase S homeolog, anticorps amino carboxymuconate semialdehyde decarboxylase, anticorps ACMSD, anticorps acmsd, anticorps acmsd.S, anticorps Acmsd

Sujet: The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders.

Poids moléculaire: 38 kDa (MW of target protein)