TNMD anticorps (Middle Region)
-
- Antigène Voir toutes TNMD Anticorps
- TNMD (Tenomodulin (TNMD))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TNMD est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Tenomodulin antibody was raised against the middle region of TNMD
- Purification
- Affinity purified
- Immunogène
- Tenomodulin antibody was raised using the middle region of TNMD corresponding to a region with amino acids QNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCI
- Top Product
- Discover our top product TNMD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Tenomodulin Blocking Peptide, catalog no. 33R-7661, is also available for use as a blocking control in assays to test for specificity of this Tenomodulin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNMD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TNMD (Tenomodulin (TNMD))
- Autre désignation
- Tenomodulin (TNMD Produits)
- Synonymes
- anticorps zgc:172161, anticorps TeM, anticorps BRICD4, anticorps CHM1L, anticorps TEM, anticorps 1110017I01Rik, anticorps Bricd4, anticorps ChM1L, anticorps tenomodulin, anticorps TNMD, anticorps tnmd, anticorps Tnmd
- Sujet
- TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.
- Poids moléculaire
- 37 kDa (MW of target protein)
-