CNNM4 anticorps (Middle Region)

N° du produit ABIN634896

Détail du produit anti-CNNM4 anticorps

Antigène: CNNM4 (Cyclin M4 (CNNM4))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CNNM4 est non-conjugé

Application: Western Blotting (WB)

Specificité: Cyclin M4 antibody was raised against the middle region of CNNM4

Purification: Affinity purified

Immunogène: Cyclin M4 antibody was raised using the middle region of CNNM4 corresponding to a region with amino acids LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cyclin M4 Blocking Peptide, catalog no. 33R-5118, is also available for use as a blocking control in assays to test for specificity of this Cyclin M4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNNM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CNNM4

Antigène: CNNM4 (Cyclin M4 (CNNM4))

Autre désignation: Cyclin M4 (CNNM4 Produits)

Synonymes: anticorps DKFZp468E0110, anticorps ACDP4, anticorps 5430430O18Rik, anticorps Acdp4, anticorps cyclin and CBS domain divalent metal cation transport mediator 4, anticorps cyclin M4, anticorps CNNM4, anticorps CpipJ_CPIJ006743, anticorps cnnm4, anticorps Cnnm4

Sujet: CNNM4 belongs to the ACDP family.It is a metal transporter. The interaction with the metal ion chaperone COX11 suggests that CNNM4 may play a role in sensory neuron functions.

Poids moléculaire: 86 kDa (MW of target protein)