DNAJB12 anticorps

N° du produit ABIN634915

Détail du produit anti-DNAJB12 anticorps

Antigène: DNAJB12 (DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNAJB12 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DNAJB12 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DNAJB12 Blocking Peptide, catalog no. 33R-4048, is also available for use as a blocking control in assays to test for specificity of this DNAJB12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNAJB12

Antigène: DNAJB12 (DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12))

Autre désignation: DNAJB12 (DNAJB12 Produits)

Synonymes: anticorps dnajb12, anticorps wu:fc16f06, anticorps wu:fi38b10, anticorps MGC82876, anticorps DNAJB12, anticorps DJ10, anticorps Dj10, anticorps mDj10, anticorps DnaJ (Hsp40) homolog, subfamily B, member 12a, anticorps DnaJ heat shock protein family (Hsp40) member B12, anticorps DnaJ heat shock protein family (Hsp40) member B12 S homeolog, anticorps dnajb12a, anticorps DNAJB12, anticorps dnajb12.S, anticorps dnajb12, anticorps Dnajb12

Sujet: DNAJB12 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity.

Poids moléculaire: 42 kDa (MW of target protein)