B3GALNT1 anticorps
-
- Antigène Voir toutes B3GALNT1 Anticorps
- B3GALNT1 (beta-1,3-N-Acetylgalactosaminyltransferase 1 (B3GALNT1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp B3GALNT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- B3 GALNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC
- Top Product
- Discover our top product B3GALNT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
B3GALNT1 Blocking Peptide, catalog no. 33R-7328, is also available for use as a blocking control in assays to test for specificity of this B3GALNT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- B3GALNT1 (beta-1,3-N-Acetylgalactosaminyltransferase 1 (B3GALNT1))
- Autre désignation
- B3GALNT1 (B3GALNT1 Produits)
- Synonymes
- anticorps B3GALT3, anticorps B3galt3, anticorps b3GT3, anticorps GLCT3, anticorps GLOB, anticorps Gb4Cer, anticorps P, anticorps P1, anticorps beta3Gal-T3, anticorps galT3, anticorps beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group), anticorps beta-1,3-N-acetylgalactosaminyltransferase 1, anticorps UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 1, anticorps B3GALNT1, anticorps B3galnt1
- Sujet
- This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. B3GALNT1 is type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates.
- Poids moléculaire
- 39 kDa (MW of target protein)
-