B3GALNT1 anticorps

N° du produit ABIN634919

L’anticorps anti-B3GALNT1 Polyclonal Lapin est utilisé pour la détection de B3GALNT1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour B3GALNT1 anticorps (ABIN634919)

Antigène: B3GALNT1 (beta-1,3-N-Acetylgalactosaminyltransferase 1 (B3GALNT1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp B3GALNT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-B3GALNT1 anticorps

Purification: Affinity purified

Immunogène: B3 GALNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

B3GALNT1 Blocking Peptide, (ABIN5612253), is also available for use as a blocking control in assays to test for specificity of this B3GALNT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur B3GALNT1

Antigène: B3GALNT1 (beta-1,3-N-Acetylgalactosaminyltransferase 1 (B3GALNT1))

Autre désignation: B3GALNT1

Sujet: This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. B3GALNT1 is type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates.

Poids moléculaire: 39 kDa (MW of target protein)