Patched 2 anticorps

N° du produit ABIN634929

Détail du produit anti-Patched 2 anticorps

Antigène: Patched 2 (PTCH2)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Patched 2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTCH2 Blocking Peptide, catalog no. 33R-4790, is also available for use as a blocking control in assays to test for specificity of this PTCH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTCH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Patched 2

Antigène: Patched 2 (PTCH2)

Autre désignation: PTCH2 (PTCH2 Produits)

Synonymes: anticorps PTC2, anticorps ptc2, anticorps Ptch1, anticorps ptc-2, anticorps xptc-2, anticorps xptch-2, anticorps patched-2, anticorps ptch2, anticorps ptc-1, anticorps ptc1, anticorps ptch1, anticorps patched 2, anticorps patched 2 S homeolog, anticorps patched 2 L homeolog, anticorps PTCH2, anticorps Ptch2, anticorps ptch2.S, anticorps ptch2.L, anticorps ptch2

Sujet: PTCH2 is a member of the patched protein family. The patched protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. The gene encoding PTCH2 is shown to be mutated in a medulloblastoma and in a basal cell carcinoma, suggesting that it plays a role in the development of some tumors.

Poids moléculaire: 130 kDa (MW of target protein)

Pathways: Signalisation Hedgehog