ATP2B4 anticorps (Middle Region)
-
- Antigène Voir toutes ATP2B4 Anticorps
- ATP2B4 (ATPase, Ca++ Transporting, Plasma Membrane 4 (ATP2B4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATP2B4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ATP2 B4 antibody was raised against the middle region of ATP2 4
- Purification
- Affinity purified
- Immunogène
- ATP2 B4 antibody was raised using the middle region of ATP2 4 corresponding to a region with amino acids FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEK
- Top Product
- Discover our top product ATP2B4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ATP2B4 Blocking Peptide, catalog no. 33R-2841, is also available for use as a blocking control in assays to test for specificity of this ATP2B4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ATP2B4 (ATPase, Ca++ Transporting, Plasma Membrane 4 (ATP2B4))
- Autre désignation
- ATP2B4 (ATP2B4 Produits)
- Synonymes
- anticorps ATP2B2, anticorps MXRA1, anticorps PMCA4, anticorps PMCA4b, anticorps PMCA4x, anticorps atp2b2, anticorps atp2b3, anticorps mxra1, anticorps pmca4, anticorps pmca4b, anticorps pmca4x, anticorps zgc:152801, anticorps ATP2B4, anticorps ATP2B1, anticorps Pmca4, anticorps ATPase plasma membrane Ca2+ transporting 4, anticorps ATPase, Ca++ transporting, plasma membrane 4 L homeolog, anticorps ATPase, Ca++ transporting, plasma membrane 4, anticorps ATP2B4, anticorps atp2b4.L, anticorps atp2b4, anticorps Atp2b4
- Sujet
- ATP2B4 belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis.
- Poids moléculaire
- 129 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-