IGSF11 anticorps (Middle Region)

N° du produit ABIN634976

Détail du produit anti-IGSF11 anticorps

Antigène: IGSF11 (Immunoglobulin Superfamily, Member 11 (IGSF11))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IGSF11 est non-conjugé

Application: Western Blotting (WB)

Specificité: IGSF11 antibody was raised against the middle region of IGSF11

Purification: Affinity purified

Immunogène: IGSF11 antibody was raised using the middle region of IGSF11 corresponding to a region with amino acids EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IGSF11 Blocking Peptide, catalog no. 33R-2510, is also available for use as a blocking control in assays to test for specificity of this IGSF11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IGSF11

Antigène: IGSF11 (Immunoglobulin Superfamily, Member 11 (IGSF11))

Autre désignation: IGSF11 (IGSF11 Produits)

Synonymes: anticorps sc:d812, anticorps seurat, anticorps BT-IgSF, anticorps CT119, anticorps CXADRL1, anticorps Igsf13, anticorps VSIG3, anticorps 1700025L02Rik, anticorps immunoglobulin superfamily member 11, anticorps immunoglobulin superfamily member 11 L homeolog, anticorps immunoglobulin superfamily, member 11, anticorps IGSF11, anticorps igsf11, anticorps igsf11.L, anticorps Igsf11

Sujet: IGSF11 functions as a cell adhesion molecule through homophilic interaction. IGSF11 stimulates cell growth.IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor and endothelial cell-selective adhesion molecule.

Poids moléculaire: 46 kDa (MW of target protein)