SEMA3D anticorps (Middle Region)
-
- Antigène Voir toutes SEMA3D Anticorps
- SEMA3D (Sema Domain, Immunoglobulin Domain (Ig), Short Basic Domain, Secreted, (Semaphorin) 3D (SEMA3D))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SEMA3D est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SEMA3 D antibody was raised against the middle region of SEMA3
- Purification
- Affinity purified
- Immunogène
- SEMA3 D antibody was raised using the middle region of SEMA3 corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
- Top Product
- Discover our top product SEMA3D Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SEMA3D Blocking Peptide, catalog no. 33R-4883, is also available for use as a blocking control in assays to test for specificity of this SEMA3D antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SEMA3D (Sema Domain, Immunoglobulin Domain (Ig), Short Basic Domain, Secreted, (Semaphorin) 3D (SEMA3D))
- Autre désignation
- SEMA3D (SEMA3D Produits)
- Synonymes
- anticorps MGC82143, anticorps Sema-Z2, anticorps coll-2, anticorps 4631426B19Rik, anticorps sema2, anticorps semaZ2, anticorps semaphorin 3D S homeolog, anticorps semaphorin 3D, anticorps sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D, anticorps sema3d.S, anticorps SEMA3D, anticorps sema3d, anticorps Sema3d
- Sujet
- SEMA3D induces the collapse and paralysis of neuronal growth cones. SEMA3D could potentially act as repulsive cues toward specific neuronal populations.
- Poids moléculaire
- 90 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-