Slc26a9 anticorps (Middle Region)
-
- Antigène Voir toutes Slc26a9 Anticorps
- Slc26a9 (Solute Carrier Family 26, Member 9 (Slc26a9))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Slc26a9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC26 A9 antibody was raised against the middle region of SLC26 9
- Purification
- Affinity purified
- Immunogène
- SLC26 A9 antibody was raised using the middle region of SLC26 9 corresponding to a region with amino acids LAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHD
- Top Product
- Discover our top product Slc26a9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC26A9 Blocking Peptide, catalog no. 33R-4781, is also available for use as a blocking control in assays to test for specificity of this SLC26A9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Slc26a9 (Solute Carrier Family 26, Member 9 (Slc26a9))
- Autre désignation
- SLC26A9 (Slc26a9 Produits)
- Synonymes
- anticorps E030002L01Rik, anticorps solute carrier family 26 member 9, anticorps solute carrier family 26, member 9, anticorps SLC26A9, anticorps Slc26a9
- Sujet
- This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns.
- Poids moléculaire
- 87 kDa (MW of target protein)
-