CUTA anticorps

N° du produit ABIN635010

Détail du produit anti-CUTA anticorps

Antigène: CUTA (Protein CutA (CUTA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CUTA est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CUTA antibody was raised using a synthetic peptide corresponding to a region with amino acids AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CUTA Blocking Peptide, catalog no. 33R-1183, is also available for use as a blocking control in assays to test for specificity of this CUTA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUTA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CUTA

Antigène: CUTA (Protein CutA (CUTA))

Autre désignation: CUTA (CUTA Produits)

Synonymes: anticorps ACHAP, anticorps C6orf82, anticorps 0610039D01Rik, anticorps 1810022E02Rik, anticorps 1810060C03Rik, anticorps 2700094G22Rik, anticorps AI326454, anticorps CutA1, anticorps cutA divalent cation tolerance homolog, anticorps CUTA, anticorps Cuta

Sujet: CUTA may forms part of a complex of membrane proteins attached to acetylcholinesterase (AChE).

Poids moléculaire: 19 kDa (MW of target protein)