WNT7B anticorps (Middle Region)

N° du produit ABIN635046

Détail du produit anti-WNT7B anticorps

Antigène: WNT7B (Wingless-Type MMTV Integration Site Family, Member 7B (WNT7B))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WNT7B est non-conjugé

Application: Western Blotting (WB)

Specificité: WNT7 B antibody was raised against the middle region of WNT7

Purification: Affinity purified

Immunogène: WNT7 B antibody was raised using the middle region of WNT7 corresponding to a region with amino acids WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WNT7B Blocking Peptide, catalog no. 33R-10029, is also available for use as a blocking control in assays to test for specificity of this WNT7B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WNT7B

Antigène: WNT7B (Wingless-Type MMTV Integration Site Family, Member 7B (WNT7B))

Autre désignation: WNT7B (WNT7B Produits)

Synonymes: anticorps WNT7B, anticorps Zwnt[c], anticorps si:ch211-239e6.2, anticorps wnt7, anticorps wnt7b, anticorps wnt[c], anticorps Xwnt-7B, anticorps Xwnt7B, anticorps wnt-7b, anticorps Wnt-7b, anticorps xwnt7b, anticorps protein Wnt-7b, anticorps wingless-type MMTV integration site family, member 7Ba, anticorps Wnt family member 7B, anticorps wingless-type MMTV integration site family, member 7B, anticorps Wnt family member 7B L homeolog, anticorps LOC525135, anticorps wnt7ba, anticorps WNT7B, anticorps wnt7b, anticorps Wnt7b, anticorps wnt7b.L

Sujet: This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Signalisation WNT