SLC25A4 anticorps
-
- Antigène Voir toutes SLC25A4 Anticorps
- SLC25A4 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 4 (SLC25A4))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC25A4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC25 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT
- Top Product
- Discover our top product SLC25A4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC25A4 Blocking Peptide, catalog no. 33R-5186, is also available for use as a blocking control in assays to test for specificity of this SLC25A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC25A4 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 4 (SLC25A4))
- Autre désignation
- SLC25A4 (SLC25A4 Produits)
- Synonymes
- anticorps 1, anticorps AAC1, anticorps ANT, anticorps ANT 1, anticorps ANT1, anticorps PEO2, anticorps PEO3, anticorps T1, anticorps AU019225, anticorps Ant1, anticorps ant, anticorps ant1, anticorps peo2, anticorps peo3, anticorps MANT1, anticorps SLC25A5, anticorps fa22e07, anticorps wu:fa22e07, anticorps zgc:77591, anticorps slc25a4, anticorps solute carrier family 25 member 4, anticorps solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 4, anticorps adenine nucleotide translocator, anticorps solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4, anticorps solute carrier family 25 member 4 L homeolog, anticorps SLC25A4, anticorps Slc25a4, anticorps slc25a4, anticorps ANT1, anticorps slc25a4.L
- Sujet
- This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.
- Poids moléculaire
- 33 kDa (MW of target protein)
- Pathways
- Proton Transport, Dicarboxylic Acid Transport
-