SLC1A2 anticorps

N° du produit ABIN635116

Détail du produit anti-SLC1A2 anticorps

Antigène: SLC1A2 (Solute Carrier Family 1 (Glial High Affinity Glutamate Transporter), Member 2 (SLC1A2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC1A2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC1 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC1A2 Blocking Peptide, catalog no. 33R-5500, is also available for use as a blocking control in assays to test for specificity of this SLC1A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC1A2

Antigène: SLC1A2 (Solute Carrier Family 1 (Glial High Affinity Glutamate Transporter), Member 2 (SLC1A2))

Autre désignation: SLC1A2 (SLC1A2 Produits)

Synonymes: anticorps CG3159, anticorps Dmel\\CG3159, anticorps EAAT, anticorps dEAAT2, anticorps dEaat2, anticorps Eaat, anticorps GB16377, anticorps EAAT2, anticorps SLC1A2, anticorps Eaat2, anticorps Glt, anticorps Glt-1, anticorps GLT-1, anticorps 1700091C19Rik, anticorps 2900019G14Rik, anticorps AI159670, anticorps GLT1, anticorps MGLT1, anticorps eaat2, anticorps fj34b12, anticorps slc1a2, anticorps wu:fj34b12, anticorps zgc:65897, anticorps Excitatory amino acid transporter 2, anticorps excitatory amino acid transporter 2, anticorps solute carrier family 1 member 2, anticorps solute carrier family 1 (glial high affinity glutamate transporter), member 2, anticorps solute carrier family 1 (glial high affinity glutamate transporter), member 2b, anticorps Eaat2, anticorps Eaat-2, anticorps SLC1A2, anticorps VDBG_06180, anticorps EUBELI_01747, anticorps Trebr_0139, anticorps Slc1a2, anticorps slc1a2b

Sujet: SLC1A2 is a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport