SPTLC1 anticorps (Middle Region)

N° du produit ABIN635128

Détail du produit anti-SPTLC1 anticorps

Antigène: SPTLC1 (serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPTLC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SPTLC1 antibody was raised against the middle region of SPTLC1

Purification: Affinity purified

Immunogène: SPTLC1 antibody was raised using the middle region of SPTLC1 corresponding to a region with amino acids DLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPTLC1 Blocking Peptide, catalog no. 33R-2041, is also available for use as a blocking control in assays to test for specificity of this SPTLC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPTLC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPTLC1

Antigène: SPTLC1 (serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1))

Autre désignation: SPTLC1 (SPTLC1 Produits)

Synonymes: anticorps ATSPT1, anticorps SERINE PALMITOYLTRANSFERASE 1, anticorps serine palmitoyltransferase 1, anticorps Afu6g00300, anticorps HSAN1, anticorps HSN1, anticorps LBC1, anticorps LCB1, anticorps SPT1, anticorps SPTI, anticorps wu:fc75h04, anticorps wu:fp41c08, anticorps zgc:112247, anticorps AW552086, anticorps C77762, anticorps E030036H05, anticorps Lcb1, anticorps RGD1306617, anticorps Spt1, anticorps serine palmitoyltransferase 1, anticorps Serine palmitoyltransferase 1, anticorps serine palmitoyltransferase long chain base subunit 1, anticorps serine palmitoyltransferase, long chain base subunit 1, anticorps serine palmitoyltransferase, long chain base subunit 1 L homeolog, anticorps SPT1, anticorps AFUA_6G00300, anticorps PAS_FragB_0040, anticorps SPTLC1, anticorps sptlc1, anticorps sptlc1.L, anticorps Sptlc1

Sujet: Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. SPTLC1 is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in SPTLC1 gene were identified in patients with hereditary sensory neuropathy type 1.

Poids moléculaire: 53 kDa (MW of target protein)