BVES anticorps (Middle Region)

N° du produit ABIN635131

Détail du produit anti-BVES anticorps

Antigène: BVES (Blood Vessel Epicardial Substance (BVES))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BVES est non-conjugé

Application: Western Blotting (WB)

Specificité: BVES antibody was raised against the middle region of BVES

Purification: Affinity purified

Immunogène: BVES antibody was raised using the middle region of BVES corresponding to a region with amino acids YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BVES Blocking Peptide, catalog no. 33R-10170, is also available for use as a blocking control in assays to test for specificity of this BVES antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BVES antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BVES

Antigène: BVES (Blood Vessel Epicardial Substance (BVES))

Autre désignation: BVES (BVES Produits)

Synonymes: anticorps HBVES, anticorps POP1, anticorps POPDC1, anticorps Pop1, anticorps Popdc1, anticorps mBVES, anticorps Popeye-1, anticorps Xbves, anticorps Xbves-A, anticorps Xpop-1, anticorps Xpop-1-A, anticorps pop-1, anticorps pop1, anticorps pop1-A, anticorps popdc1, anticorps popdc1-A, anticorps zgc:86887, anticorps BVES, anticorps Xpop-1-B, anticorps bves, anticorps pop1-B, anticorps popdc1-B, anticorps hbves, anticorps blood vessel epicardial substance, anticorps blood vessel epicardial substance L homeolog, anticorps blood vessel epicardial substance S homeolog, anticorps BVES, anticorps Bves, anticorps bves.L, anticorps bves, anticorps bves.S

Sujet: This gene encodes a member of the POP family of proteins containing three putative transmembrane domains. This gene is expressed in cardiac and skeletal muscle and may play an important role in development of these tissues. The mouse ortholog may be involved in the regeneration of adult skeletal muscle and may act as a cell adhesion molecule in coronary vasculogenesis. Two transcript variants encoding the same protein have been found for this gene.

Poids moléculaire: 41 kDa (MW of target protein)