SLC6A5 anticorps
-
- Antigène Voir toutes SLC6A5 Anticorps
- SLC6A5 (Solute Carrier Family 6 (Neurotransmitter Transporter, Glycine), Member 5 (SLC6A5))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC6A5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC6 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE
- Top Product
- Discover our top product SLC6A5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC6A5 Blocking Peptide, catalog no. 33R-5068, is also available for use as a blocking control in assays to test for specificity of this SLC6A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC6A5 (Solute Carrier Family 6 (Neurotransmitter Transporter, Glycine), Member 5 (SLC6A5))
- Autre désignation
- SLC6A5 (SLC6A5 Produits)
- Synonymes
- anticorps SLC6A5, anticorps Glyt2, anticorps prestin, anticorps GLYT-2, anticorps GLYT2, anticorps HKPX3, anticorps NET1, anticorps solute carrier family 6 member 5, anticorps solute carrier family 6 (neurotransmitter transporter, glycine), member 5, anticorps SLC6A5, anticorps Slc6a5
- Sujet
- This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission.
- Poids moléculaire
- 87 kDa (MW of target protein)
-