FMO3 anticorps (N-Term)
-
- Antigène Voir toutes FMO3 Anticorps
- FMO3 (Flavin Containing Monooxygenase 3 (FMO3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FMO3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FMO3 antibody was raised against the N terminal of FMO3
- Purification
- Affinity purified
- Immunogène
- FMO3 antibody was raised using the N terminal of FMO3 corresponding to a region with amino acids FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE
- Top Product
- Discover our top product FMO3 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FMO3 Blocking Peptide, catalog no. 33R-2997, is also available for use as a blocking control in assays to test for specificity of this FMO3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FMO3 (Flavin Containing Monooxygenase 3 (FMO3))
- Autre désignation
- FMO3 (FMO3 Produits)
- Synonymes
- anticorps MGC107820, anticorps FMOII, anticorps TMAU, anticorps dJ127D3.1, anticorps FM03, anticorps AW111792, anticorps flavin containing monooxygenase 3, anticorps flavin containing monooxygenase 3 L homeolog, anticorps FMO3, anticorps fmo3, anticorps fmo3.L, anticorps Fmo3
- Sujet
- FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide.
- Poids moléculaire
- 59 kDa (MW of target protein)
-