ALDH3A2 anticorps (Middle Region)
-
- Antigène Voir toutes ALDH3A2 Anticorps
- ALDH3A2 (Aldehyde Dehydrogenase 3 Family, Member A2 (ALDH3A2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALDH3A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ALDH3 A2 antibody was raised against the middle region of ALDH3 2
- Purification
- Affinity purified
- Immunogène
- ALDH3 A2 antibody was raised using the middle region of ALDH3 2 corresponding to a region with amino acids DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR
- Top Product
- Discover our top product ALDH3A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALDH3A2 Blocking Peptide, catalog no. 33R-1975, is also available for use as a blocking control in assays to test for specificity of this ALDH3A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALDH3A2 (Aldehyde Dehydrogenase 3 Family, Member A2 (ALDH3A2))
- Autre désignation
- ALDH3A2 (ALDH3A2 Produits)
- Synonymes
- anticorps ALDH10, anticorps FALDH, anticorps SLS, anticorps AI194803, anticorps Ahd-3, anticorps Ahd-3r, anticorps Ahd3, anticorps Ahd3-r, anticorps Aldh4, anticorps Aldh4-r, anticorps ALDH-III, anticorps CG11140, anticorps CT41571, anticorps Dhap, anticorps Dmel\\CG11140, anticorps l(2)03610, anticorps Aldh-III, anticorps aldh3a2, anticorps wu:fc06b11, anticorps zgc:92064, anticorps ALDH3A2, anticorps aldehyde dehydrogenase 3 family member A2, anticorps aldehyde dehydrogenase family 3, subfamily A2, anticorps aldehyde dehydrogenase 3 family, member A2, anticorps Aldehyde dehydrogenase type III, anticorps fatty aldehyde dehydrogenase, anticorps aldehyde dehydrogenase 3 family, member A2a, anticorps aldehyde dehydrogenase 3 family member A2 S homeolog, anticorps aldH, anticorps ALDH3A2, anticorps Aldh3a2, anticorps Aldh-III, anticorps PTRG_02589, anticorps aldh3a2, anticorps aldh3a2a, anticorps aldh3a2.S, anticorps aldH
- Sujet
- Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. ALDH3A2 catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid.
- Poids moléculaire
- 58 kDa (MW of target protein)
-