FNDC4 anticorps (Middle Region)

N° du produit ABIN635170

Détail du produit anti-FNDC4 anticorps

Antigène: FNDC4 (Fibronectin Type III Domain Containing 4 (FNDC4))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FNDC4 est non-conjugé

Application: Western Blotting (WB)

Specificité: FNDC4 antibody was raised against the middle region of FNDC4

Purification: Affinity purified

Immunogène: FNDC4 antibody was raised using the middle region of FNDC4 corresponding to a region with amino acids EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FNDC4 Blocking Peptide, catalog no. 33R-2440, is also available for use as a blocking control in assays to test for specificity of this FNDC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNDC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FNDC4

Antigène: FNDC4 (Fibronectin Type III Domain Containing 4 (FNDC4))

Autre désignation: FNDC4 (FNDC4 Produits)

Synonymes: anticorps 2810430J06Rik, anticorps 6330410H20Rik, anticorps AB030187, anticorps AI838506, anticorps AW487863, anticorps FRCP1, anticorps Fnmp1, anticorps FNDC4, anticorps fibronectin type III domain containing 4, anticorps Fndc4, anticorps FNDC4, anticorps fndc4

Sujet: The function of Fibronectin protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 25 kDa (MW of target protein)