SPOCK3 anticorps

N° du produit ABIN635182

Cet anticorps Lapin Polyclonal détecte spécifiquement SPOCK3 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour SPOCK3 anticorps (ABIN635182)

Antigène: SPOCK3 (Sparc/osteonectin, Cwcv and Kazal-Like Domains Proteoglycan (Testican) 3 (SPOCK3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPOCK3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SPOCK3 anticorps

Purification: Affinity purified

Immunogène: SPOCK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMND

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPOCK3 Blocking Peptide, (ABIN5616375), is also available for use as a blocking control in assays to test for specificity of this SPOCK3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPOCK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPOCK3

Antigène: SPOCK3 (Sparc/osteonectin, Cwcv and Kazal-Like Domains Proteoglycan (Testican) 3 (SPOCK3))

Autre désignation: SPOCK3

Sujet: Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 is a member of a novel Ca(2+)-binding proteoglycan family .

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process