SPOCK3 anticorps
-
- Antigène Voir toutes SPOCK3 Anticorps
- SPOCK3 (Sparc/osteonectin, Cwcv and Kazal-Like Domains Proteoglycan (Testican) 3 (SPOCK3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SPOCK3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SPOCK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMND
- Top Product
- Discover our top product SPOCK3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SPOCK3 Blocking Peptide, catalog no. 33R-9479, is also available for use as a blocking control in assays to test for specificity of this SPOCK3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPOCK3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SPOCK3 (Sparc/osteonectin, Cwcv and Kazal-Like Domains Proteoglycan (Testican) 3 (SPOCK3))
- Autre désignation
- SPOCK3 (SPOCK3 Produits)
- Synonymes
- anticorps im:7139568, anticorps si:dkey-285b22.1, anticorps HSAJ1454, anticorps TES-3, anticorps TICN3, anticorps Testican-3, anticorps 2900045C01Rik, anticorps AI428471, anticorps mKIAA4039, anticorps sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3, anticorps SPARC/osteonectin, cwcv and kazal like domains proteoglycan 3, anticorps sparc/osteonectin, cwcv and kazal-like domains proteoglycan 3, anticorps spock3, anticorps SPOCK3, anticorps Spock3
- Sujet
- Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 is a member of a novel Ca(2+)-binding proteoglycan family .
- Poids moléculaire
- 49 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-