PIGQ anticorps (N-Term)
-
- Antigène Voir toutes PIGQ Anticorps
- PIGQ (Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q (PIGQ))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PIGQ est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PIGQ antibody was raised against the N terminal of PIGQ
- Purification
- Affinity purified
- Immunogène
- PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids VLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESL
- Top Product
- Discover our top product PIGQ Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PIGQ Blocking Peptide, catalog no. 33R-9665, is also available for use as a blocking control in assays to test for specificity of this PIGQ antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGQ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PIGQ (Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q (PIGQ))
- Autre désignation
- PIGQ (PIGQ Produits)
- Synonymes
- anticorps GPI1, anticorps c407A10.1, anticorps Gpi1, anticorps Gpi1h, anticorps Gpi1p, anticorps Gpih, anticorps phosphatidylinositol glycan anchor biosynthesis class Q, anticorps phosphatidylinositol glycan anchor biosynthesis, class Q, anticorps PIGQ, anticorps Pigq
- Sujet
- PIGQ is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGQ is a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI).
- Poids moléculaire
- 84 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-