SLC7A4 anticorps
-
- Antigène Voir toutes SLC7A4 Anticorps
- SLC7A4 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC7A4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC7 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFIVAAGSICAMN
- Top Product
- Discover our top product SLC7A4 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC7A4 Blocking Peptide, catalog no. 33R-3182, is also available for use as a blocking control in assays to test for specificity of this SLC7A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC7A4 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4))
- Autre désignation
- SLC7A4 (SLC7A4 Produits)
- Synonymes
- anticorps MGC83777, anticorps SLC7A4, anticorps MGC147458, anticorps si:busm1-266f07.3, anticorps si:dz266f07.3, anticorps AI853530, anticorps CAT-4, anticorps CAT4, anticorps HCAT3, anticorps VH, anticorps solute carrier family 7 member 4, anticorps solute carrier family 7 member 4 L homeolog, anticorps cationic amino acid transporter 4, anticorps solute carrier family 7, member 4, anticorps solute carrier family 7 (cationic amino acid transporter, y+ system), member 4, anticorps SLC7A4, anticorps slc7a4.L, anticorps slc7a4, anticorps LOC100056096, anticorps Slc7a4
- Sujet
- SLC7A4 is involved in the transport of the cationic amino acids (arginine, lysine and ornithine).
- Poids moléculaire
- 68 kDa (MW of target protein)
-