RNF185 anticorps (Middle Region)

N° du produit ABIN635239

Détail du produit anti-RNF185 anticorps

Antigène: RNF185 (Ring Finger Protein 185 (RNF185))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF185 est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF185 antibody was raised against the middle region of RNF185

Purification: Affinity purified

Immunogène: RNF185 antibody was raised using the middle region of RNF185 corresponding to a region with amino acids QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF185 Blocking Peptide, catalog no. 33R-7767, is also available for use as a blocking control in assays to test for specificity of this RNF185 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF185 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF185

Antigène: RNF185 (Ring Finger Protein 185 (RNF185))

Autre désignation: RNF185 (RNF185 Produits)

Synonymes: anticorps zgc:73070, anticorps xrnf185, anticorps 1700022N24Rik, anticorps AL033296, anticorps ring finger protein 185, anticorps ring finger protein 185 L homeolog, anticorps rnf185, anticorps rnf185.L, anticorps RNF185, anticorps Rnf185

Sujet: The exact function of RNF185 remains unknown.

Poids moléculaire: 20 kDa (MW of target protein)