RNF185 anticorps (Middle Region)
-
- Antigène Voir toutes RNF185 Anticorps
- RNF185 (Ring Finger Protein 185 (RNF185))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNF185 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RNF185 antibody was raised against the middle region of RNF185
- Purification
- Affinity purified
- Immunogène
- RNF185 antibody was raised using the middle region of RNF185 corresponding to a region with amino acids QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF
- Top Product
- Discover our top product RNF185 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNF185 Blocking Peptide, catalog no. 33R-7767, is also available for use as a blocking control in assays to test for specificity of this RNF185 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF185 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNF185 (Ring Finger Protein 185 (RNF185))
- Autre désignation
- RNF185 (RNF185 Produits)
- Synonymes
- anticorps zgc:73070, anticorps xrnf185, anticorps 1700022N24Rik, anticorps AL033296, anticorps ring finger protein 185, anticorps ring finger protein 185 L homeolog, anticorps rnf185, anticorps rnf185.L, anticorps RNF185, anticorps Rnf185
- Sujet
- The exact function of RNF185 remains unknown.
- Poids moléculaire
- 20 kDa (MW of target protein)
-